PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G24960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 373aa    MW: 39512.9 Da    PI: 6.4432
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G24960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-172875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+llvd v+++G g+W+++ r+ g+ R++k+c++rw ++l
  OMERI06G24960.1 28 KGPWTQAEDKLLVDHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 75
                     79******************************************9986 PP

2Myb_DNA-binding452.4e-1481124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l+++++ +lG++ W++I++++  gRt++++k++w++
  OMERI06G24960.1  81 KGPFSPDEERLILRLHGLLGNK-WARISSYLH-GRTDNEIKNYWNT 124
                      79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0752375IPR017930Myb domain
SuperFamilySSF466892.77E-3025122IPR009057Homeodomain-like
SMARTSM007171.6E-132777IPR001005SANT/Myb domain
PfamPF002495.7E-152875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-222982IPR009057Homeodomain-like
CDDcd001671.44E-113075No hitNo description
PROSITE patternPS0017504352IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129424.66376130IPR017930Myb domain
SMARTSM007171.7E-1480128IPR001005SANT/Myb domain
PfamPF002491.0E-1381124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2483130IPR009057Homeodomain-like
CDDcd001673.86E-1083126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MARSGGGNGG GEGGGGGGNG GGGGGLKKGP WTQAEDKLLV DHVRRHGEGN WNAVRRETGL  60
QRCGKSCRLR WANHLRPDLR KGPFSPDEER LILRLHGLLG NKWARISSYL HGRTDNEIKN  120
YWNTRLKRRV RAGLTPYPPE IEREIAHLRA QNLNLSAEGG GGGGGGMLPP PLLLDPSNPF  180
ALQAPSPSAS QANSPPRELP SNQFETATSG GGGGDALLES LLLGDDHLLP RPNPAMLRVG  240
SMPELMYREP SSSHVLHGGG GASDSDVTSQ YPPGEEDPHY GGRWDFIFED VKPKRKAASA  300
VEEEISGMFG IAPGSIPGEW FSPGGVGGGA AGSSAPSPGP SSVVTTDDDF TLEMQQIMSS  360
LPLLQPEEHN WNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28261305108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130RLKRRVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116970.0AK111697.1 Oryza sativa Japonica Group cDNA clone:J023004F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693682.11e-141PREDICTED: myb-related protein Myb4, partial
TrEMBLA0A0E0E5C50.0A0A0E0E5C5_9ORYZ; Uncharacterized protein
STRINGSi006555m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-57myb domain protein 101